PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G004300.2
Common NamePHAVU_009G004300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SRS
Protein Properties Length: 216aa    MW: 23743.5 Da    PI: 8.7325
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G004300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70288.21.8e-271465455
              DUF702  4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqq 55
                         +++CqdCGnqakk+C+++RCRtCCk++gf+C+th++stW p++krr+  q 
  Phvul.009G004300.2 14 RGSKCQDCGNQAKKECSYSRCRTCCKNKGFKCQTHIRSTWTPVDKRRNTEQP 65
                        5679*******************************************97554 PP

2DUF70275.21.9e-2390142102154
              DUF702 102 tsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                           ++P   +s+a+frcv+v+s+dd+ +e+aYqt+v+igGhvf+GiLydqG+e+
  Phvul.009G004300.2  90 EMKFPGAANSMAMFRCVQVRSMDDAVNEVAYQTSVNIGGHVFSGILYDQGPEQ 142
                         345************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.4E-4215141IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.2E-231759IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.0E-2092140IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MKRGTQGEEE VVSRGSKCQD CGNQAKKECS YSRCRTCCKN KGFKCQTHIR STWTPVDKRR  60
NTEQPPSPPH NFHGDVPQKH NQINPYSGLE MKFPGAANSM AMFRCVQVRS MDDAVNEVAY  120
QTSVNIGGHV FSGILYDQGP EQGYNHKGGS SSGLVDEQQR NNLGLMNNAS IHSRDSSGVT  180
IASAGHGEPL FPPPPYPFPL ASFRPGMPYF TYPRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-118AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007135937.11e-162hypothetical protein PHAVU_009G004300g
TrEMBLV7AUN51e-162V7AUN5_PHAVU; Uncharacterized protein
STRINGGLYMA04G01125.11e-89(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.12e-42Lateral root primordium (LRP) protein-related